3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Anti-BNP-32 Antibody, Biotinylated
Catalog #: RB-13-0001B-50
Rabbit anti-BNP-32 Biotinylated Antibody, 50 ug
Product Description
Specifications
| Size | 50 µg |
| Estimated Lead Time | 1-2 business days |
| Species | Human |
| Host Species | Rabbit |
| Accession Number | P16860 |
| Gene Id | 4879 |
| Gene Symbols | NPPB |
| Clonality | Polyclonal |
| Immunogen | The imunogen was synthetic peptide. This antibody was produced from a rabbit immunized with the immunogen. The IgG fraction was purified from rabbit serum followed by Protein A/G affinity chromatography. |
| Immunogen Sequence | SPKMVQGSGCFGRKMDRSSSSGLGCKVLRRH |
| Isotype | IgG |
| Recommended Applications | ELISA (recommended work dilution= 1:2000) |
| Reconstitution | A separate vial of dilution buffer is provided for reconstitution. The antibody is supplied lyophilized, originally containing PBS, without preservative stabilizers (e.g. sodium azide). The final amount is indicated on the shipping vial. |
| Research Area | Angiogenesis, Neuroscience, Cardiovascular Disease |
| Shipping Type | Ambient temperature |
| Storage | -20°C |
Description
Description
A polyhistidine-tag is an amino acid motif in proteins that consists of at least five histidine (His) residues, often at the N- or C-terminus of the protein. It is also known as hexa-histidine tag, 6xHis-tag, and by the trademarked name His-tag. Polyhistidine-tags are often used for affinity purification of genetically modified proteins.
Storage / Stability
The antibody is stable for at least 1 year from the date of receipt when stored at -20°C to -70°C. Reconstituted antibody can also be aliquotted and stored at 4°C for 1 month or at -20°C to -70°C in a manual defrost freezer for many months without detectable loss activity. Please avoid freeze-thaw cycles.
Specificity
This antibody binds to its immunogen, and did not show any cross reactivity with unrelated antigens in ELISA.
Related Products
Mouse anti-human-HA-Tag (catalog #: RB-IP-10-101 )
References
- Maisel, A. et al., (2002). "Rapid measurement of B-type natriuretic peptide in the emergency diagnosis of heart failure". N Engl J Med 347 (3): 1617.
- Bhalla, V. et al., (2004). "B-type natriuretic peptide: the level and the drug--partners in the diagnosis of congestive heart failure". Congest Heart Fail 10 (1 Suppl 1): 327.
Expiration:
12 months from the date of shipment when stored properly.