3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Anti-Ferritin (N-term) Antibody
Catalog #: 130-10047
Rabbit Anti-Human Ferritin (N-term) Antibody
Product Description
Specifications
| Size | 20 µg, 100 µg, 200 µg, 500 µg |
| Estimated Lead Time | 1-2 business days |
| Species | Human |
| Specificity | The antibody can specifically bind to its immunogen, and did not show any cross reactivity with unrelated antigens in ELISA. The specificity for binding to recombinant protein, cellular protein and native antigen is not defined. Cross reactivity with mouse and rat Ferritin has not yet been tested. |
| Accession Number | P02794 |
| Gene Id | 2495 |
| Gene Symbols | FTH1 FTH FTHL6 OK/SW-cl.84 PIG15 |
| Clonality | Polyclonal |
| Immunogen | Immunogen was synthetic peptide derived from human Ferritin. This antibody was produced from a rabbit immunized with the immunogen. The IgG fraction was purified from rabbit serum by ammonium sulphate precipitation, and followed by Protein A/G affinity chromatography. |
| Immunogen Sequence | CRAKNKIAKETNNKKKEFEETAEKVRCNSLVNLYLQASYTYLSLGFYFDR |
| Recommended Applications | ELISA (recommended work dilution= 1:20000 (at least detecting 50ng/ml)) |
| Reconstitution | Supplied as lyophilized and purified antibody originally containing PBS, without Preservative Stabilizers, such as Sodium Azide. The final concentration is indicated on the shipping vial. The antibody is stable for at least years from the data of receipt when stored at -20°C to -70°C. Reconstituted antibody (recommended with H20 1 mg/ml) can also be aliquoted and stored frozen at -20°C to -70°C in a manual defrost freezer for months without detectable loss activity. Upon reconstitution, the antibody can also be stored over months at 4°C. Please avoid freeze-thaw cycles. |
| Research Area | Cardiovascular Disease |
| Shipping Type | Ambient temperature |
| Storage | -20°C |
Description
Description
Ferritin is a protein of 450 kDa consisting of 24 subunits that is present in every cell type.In vertebrates, these subunits are both the light (L) and the heavy (H) type with an apparent molecular weight of 19 kDA or 21 kDA respectively; their sequences are about 50% homologous. Ferritin concentrations increase drastically in the presence of an infection or cancer; this is necessary to counter the infective agent's attempt to bind iron from the host's tissue. The inflammatory response may cause ferritin to migrate from the plasma to within cells, in order to deny iron to the infective agent. Serum ferritin levels are measured in patients as part of the iron studies workup for anemia and for restless legs syndrome. The ferritin levels measured usually have a direct correlation with the total amount of iron stored in the body. However, ferritin levels may be artificially high in cases of anemia of chronic disease where ferritin is elevated in its capacity as an acute phase protein and not as a marker for iron overload.
Typical Data
Storage/Stability
Keep it at 4°C if intended for use within a month. Store at -20°C if over months. Minimize freezing and thawing when use.
Expiration
12 months from the date of shipment when stored properly.
References
- Eshed I, et al..(2001) Plasma ferritin and type 2 diabetes mellitus: a critical review. Endocr Res. 27(1-2):91-7.
- Nelson RL. (2001) Iron and colorectal cancer risk: human studies. Nutr Rev. 59(5):140-8.