3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-10604
Human GAPDH monoclonal antibody (200 uL)
| Size | 200 µL |
| Estimated Lead Time | 1-2 weeks |
| Species | Human, Mouse, Rat |
| Host Species | Mouse |
| Accession Number | NP_002037 |
| Gene Id | 2597 |
| Gene Symbols | GAPDH |
| Protein Name / Synonyms | G3PD, GAPD, MGC88685 |
| Clonality | Monoclonal |
| Immunogen Sequence | GKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQA SEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALND HFVKLISWYDNEFGYSNRVVDLMAHMASKE |
| Isotype | Kappa, IgG1 |
| Recommended Applications | Western Blotting, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (37.84 KDa). |
![]() | GAPDH monoclonal antibody Western Blot analysis of GAPDH expression in HeLa . |
![]() | GAPDH monoclonal antibody Western Blot analysis of GAPDH expression in A-431 . |
![]() | Western Blot analysis of GAPDH expression in transfected 293T cell line by GAPDH monoclonal antibody. Lane 1: GAPDH transfected lysate(36.1 KDa). Lane 2: Non-transfected lysate. |
Your cart is empty.