Anti-PIK3CG Antibody

Product Description

Size	100 µg
Estimated Lead Time	1-2 weeks
Species	Human
Host Species	Mouse
Accession Number	AAH35683
Gene Id	5294
Gene Symbols	PIK3CG
Protein Name / Synonyms	PI3CG, PI3K, PI3Kgamma, PIK3
Clonality	Monoclonal
Immunogen Sequence	MELENYKQPVVLREDNCRRRRRMKPRSAAASLSSMELIPI EFVLPTSQRKCKSPETALLHVAGHGNVEQMKAQVWLRALE TSVAADFYHRLGPHHFLLLY
Isotype	Kappa, IgG2a
Recommended Applications	Immunofluorescence, Proximity Ligation Analysis, ELISA, Western Blotting
Shipping Type	Blue ice
Storage	-20°C
More Information	Specificity Human

PI3CG, PI3K, PI3Kgamma, PIK3

Mouse monoclonal antibody raised against a partial recombinant PIK3CG.

Specificity

Human

Gene Accession #

BC035683

Storage Buffer

1x PBS, pH 7.2

	Western Blot detection against Immunogen (37 KDa).
	Proximity Ligation Analysis of protein-protein interactions between KIT and PIK3CG HeLa cells were stained with anti-KIT rabbit purified polyclonal 1:1200 and anti-PIK3CG mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
	Immunofluorescence of monoclonal antibody to PIK3CG on HeLa cell. [antibody concentration 10 ug/ml]
	Detection limit for recombinant GST tagged PIK3CG is approximately 10ng/ml as a capture antibody.

Storage Recommendations

Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Expiration:

12 months from the date of shipment when stored properly.

Product Description