3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11339
Human PSIP1 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH33817 |
| Gene Id | 11168 |
| Gene Symbols | PSIP1 |
| Protein Name / Synonyms | DFS70, LEDGF, MGC74712, PAIP, PSIP2, p52, p75 |
| Clonality | Monoclonal |
| Immunogen Sequence | MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKL PIFFFGTHET |
| Isotype | Kappa, IgG1 |
| Recommended Applications | Western Blotting, ELISA, IHC |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (31.13 KDa). |
![]() | PSIP1 monoclonal antibody Western Blot analysis of PSIP1 expression in human liver. |
![]() | Immunoperoxidase of monoclonal antibody to PSIP1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml] |
![]() | Detection limit for recombinant GST tagged PSIP1 is approximately 1ng/ml as a capture antibody. |
Your cart is empty.