3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Anti-PYY-P1 Antibody
Catalog #: 130-10473
Rabbit anti-PYY-P1 Antibody
Product Description
Specifications
| Size | 20 µg, 100 µg, 200 µg, 500 µg |
| Estimated Lead Time | 1-2 business days |
| Species | Human |
| Accession Number | P10082 |
| Gene Id | 5697 |
| Gene Symbols | PYY |
| Protein Name / Synonyms | Peptide YY (PYY) (PYY-I) (Peptide tyrosine tyrosine) [Cleaved into: Peptide YY(3-36) (PYY-II)] |
| Immunogen | This antibody was produced from antiserum of rabbits immunized with a synthetic immunogen(PYY-P1: 29~64aa:NH2-YPIKPEAPREDASPEELNRYYASLRHYLNLVTRQRYC). This antibody was produced from a rabbit immunized with this peptide conjugated with KLH. The IgG fraction was purified by Protein A affinity chromatography. |
| Immunogen Sequence | YPIKPEAPREDASPEELNRYYASLRHYLNLVTRQRYC |
| Recommended Applications | ELISA (recommended work dilution= 1:128, 000) |
| Reconstitution | Product is supplied as a powder obtained from lyophilization of purified antibody in 1X PBS, aliquot using ddH2O. Reconstitute the antibody with sterile water to a final concentration of 1 mg/ml. |
| Shipping Type | Ambient temperature |
| Storage | -20°C |
Description
Description
Peptide YY (PYY) also known as peptide tyrosine tyrosine or pancreatic peptide YY3-36 is a peptide that in humans is encoded by the PYY gene.Peptide YY is a short (36-amino acid) peptide released by cells in the ileum and colon in response to feeding. In the blood, gut, and other elements of periphery, PYY acts to reduce appetite; but when injected directly into the central nervous system, PYY is anorexigenic, i.e., it decreases appetite.Peptide YY can be produced as the result of enzymatic breakdown of crude fish proteins and ingested as a food product.
Storage
The antibody is stable for at least 1 year from the date of receipt when stored at -20°C to -70°C. Reconstituted antibody can also be aliquotted and stored at 4°C for 1 month or at -20°C to -70°C in a manual defrost freezer for many months without detectable loss activity. Please avoid freeze-thaw cycles.
Expiration:
12 months from the date of shipment when stored properly.