3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 130-10473
Rabbit anti-PYY-P1 Antibody
| Size | 20 µg, 100 µg, 200 µg, 500 µg |
| Estimated Lead Time | 1-2 business days |
| Species | Human |
| Accession Number | P10082 |
| Gene Id | 5697 |
| Gene Symbols | PYY |
| Protein Name / Synonyms | Peptide YY (PYY) (PYY-I) (Peptide tyrosine tyrosine) [Cleaved into: Peptide YY(3-36) (PYY-II)] |
| Immunogen | This antibody was produced from antiserum of rabbits immunized with a synthetic immunogen(PYY-P1: 29~64aa:NH2-YPIKPEAPREDASPEELNRYYASLRHYLNLVTRQRYC). This antibody was produced from a rabbit immunized with this peptide conjugated with KLH. The IgG fraction was purified by Protein A affinity chromatography. |
| Immunogen Sequence | YPIKPEAPREDASPEELNRYYASLRHYLNLVTRQRYC |
| Recommended Applications | ELISA (recommended work dilution= 1:128, 000) |
| Reconstitution | Product is supplied as a powder obtained from lyophilization of purified antibody in 1X PBS, aliquot using ddH2O. Reconstitute the antibody with sterile water to a final concentration of 1 mg/ml. |
| Shipping Type | Ambient temperature |
| Storage | -20°C |
Your cart is empty.