3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 130-10473B-50
Rabbit anti-PYY-P1 Biotinylated Antibody, 50 ug
| Size | 50 µg |
| Estimated Lead Time | 1-2 business days |
| Species | Human |
| Host Species | Rabbit |
| Accession Number | P10082 |
| Gene Id | 5697 |
| Gene Symbols | PYY |
| Protein Name / Synonyms | Peptide YY (PYY) (PYY-I) (Peptide tyrosine tyrosine) [Cleaved into: Peptide YY(3-36) (PYY-II)] |
| Clonality | Polyclonal |
| Immunogen | This antibody was produced from antiserum of rabbits immunized with a synthetic immunogen(PYY-P1: 29~64aa:NH2-YPIKPEAPREDASPEELNRYYASLRHYLNLVTRQRYC). This antibody was produced from a rabbit immunized with this peptide conjugated with KLH. The IgG fraction was purified by Protein A affinity chromatography. |
| Immunogen Sequence | YPIKPEAPREDASPEELNRYYASLRHYLNLVTRQRYC |
| Isotype | IgG |
| Recommended Applications | ELISA (recommended work dilution= 1:128, 000) |
| Reconstitution | A separate vial of dilution buffer is provided for reconstitution. The antibody is supplied lyophilized, originally containing PBS, without preservative stabilizers (e.g. sodium azide). The final amount is indicated on the shipping vial. |
| Shipping Type | Ambient temperature |
| Storage | -20°C |
Your cart is empty.