3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Anti-PYY-P1 Antibody, Biotinylated
Catalog #: 130-10473B-50
Rabbit anti-PYY-P1 Biotinylated Antibody, 50 ug
Product Description
Specifications
| Size | 50 µg |
| Estimated Lead Time | 1-2 business days |
| Species | Human |
| Host Species | Rabbit |
| Accession Number | P10082 |
| Gene Id | 5697 |
| Gene Symbols | PYY |
| Protein Name / Synonyms | Peptide YY (PYY) (PYY-I) (Peptide tyrosine tyrosine) [Cleaved into: Peptide YY(3-36) (PYY-II)] |
| Clonality | Polyclonal |
| Immunogen | This antibody was produced from antiserum of rabbits immunized with a synthetic immunogen(PYY-P1: 29~64aa:NH2-YPIKPEAPREDASPEELNRYYASLRHYLNLVTRQRYC). This antibody was produced from a rabbit immunized with this peptide conjugated with KLH. The IgG fraction was purified by Protein A affinity chromatography. |
| Immunogen Sequence | YPIKPEAPREDASPEELNRYYASLRHYLNLVTRQRYC |
| Isotype | IgG |
| Recommended Applications | ELISA (recommended work dilution= 1:128, 000) |
| Reconstitution | A separate vial of dilution buffer is provided for reconstitution. The antibody is supplied lyophilized, originally containing PBS, without preservative stabilizers (e.g. sodium azide). The final amount is indicated on the shipping vial. |
| Shipping Type | Ambient temperature |
| Storage | -20°C |
Description
Description
Peptide YY (PYY) also known as peptide tyrosine tyrosine or pancreatic peptide YY3-36 is a peptide that in humans is encoded by the PYY gene.Peptide YY is a short (36-amino acid) peptide released by cells in the ileum and colon in response to feeding. In the blood, gut, and other elements of periphery, PYY acts to reduce appetite; but when injected directly into the central nervous system, PYY is anorexigenic, i.e., it decreases appetite.Peptide YY can be produced as the result of enzymatic breakdown of crude fish proteins and ingested as a food product.
Storage
The antibody is stable for at least 1 year from the date of receipt when stored at -20°C to -70°C. Reconstituted antibody can also be aliquotted and stored at 4°C for 1 month or at -20°C to -70°C in a manual defrost freezer for many months without detectable loss activity. Please avoid freeze-thaw cycles.
Expiration:
12 months from the date of shipment when stored properly.