3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11424
Human RBPJ monoclonal antibody (200 uL)
| Size | 200 µL |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_976029 |
| Gene Id | 3516 |
| Gene Symbols | RBPJ |
| Protein Name / Synonyms | CBF1, IGKJRB, IGKJRB1, KBF2, MGC61669, RBP-J, RBPJK, RBPSUH, SUH, csl |
| Clonality | Monoclonal |
| Immunogen Sequence | WIKRKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVA QKSYGNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQE SQPCAFIGIGNSDQEMQQLNLEGKNYC |
| Isotype | Kappa, IgG2b |
| Recommended Applications | Western Blotting, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (37.51 KDa). |
![]() | RBPJ monoclonal antibody Western Blot analysis of RBPJ expression in Jurkat . |
![]() | Western Blot analysis of RBPJ expression in transfected 293T cell line by RBPJ monoclonal antibody . Lane 1: RBPJ transfected lysate(54.3 KDa). Lane 2: Non-transfected lysate. |
Your cart is empty.