3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11446
Human RHOA monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH01360 |
| Gene Id | 387 |
| Gene Symbols | RHOA |
| Protein Name / Synonyms | ARH12, ARHA, RHO12, RHOH12 |
| Clonality | Monoclonal |
| Immunogen Sequence | MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFE NYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVI LMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECS AKTKDGVREVFEMATRAALQARRGKKKSGCLVL |
| Isotype | Kappa, IgG1 |
| Recommended Applications | Proximity Ligation Analysis, ELISA, Western Blotting, IHC |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (46.97 KDa). |
![]() | RHOA monoclonal antibody Western Blot analysis of RHOA expression in HeLa . |
![]() | Western Blot analysis of RHOA expression in transfected 293T cell line by RHOA monoclonal antibody. Lane 1: RHOA transfected lysate(21.8 KDa). Lane 2: Non-transfected lysate. |
![]() | Proximity Ligation Analysis of protein-protein interactions between MAPK8 and RHOA HeLa cells were stained with anti-MAPK8 rabbit purified polyclonal 1:1200 and anti-RHOA mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue). |
![]() | Immunoperoxidase of monoclonal antibody to RHOA on formalin-fixed paraffin-embedded human tonsil tissue.[antibody concentration 5 ug/ml] |
![]() | Detection limit for recombinant GST tagged RHOA is 3 ng/ml as a capture antibody. |
Your cart is empty.