3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11485
Human RPLP1 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_000994.1 |
| Gene Id | 6176 |
| Gene Symbols | RPLP1 |
| Clonality | Monoclonal |
| Immunogen Sequence | MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVE PFWPGLFAKALANVNIGSLICNVGAGGPAPAAGAAPAGGP APSTAAAPAEEKKVEAKKEESEESDDDMGFGLFD |
| Isotype | Kappa, IgG2a |
| Concentration (lot specific) | 1mg/ml |
| Recommended Applications | Immunofluorescence, Western Blotting, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
![]() | Western Blot detection against Immunogen (37.9 KDa). |
![]() | Western Blot analysis of RPLP1 expression in transfected 293T cell line by RPLP1 monoclonal antibody . Lane 1: RPLP1 transfected lysate (Predicted MW: 11.5 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunofluorescence of monoclonal antibody to RPLP1 on HeLa cell. [antibody concentration 10 ug/ml] |
![]() | Detection limit for recombinant GST tagged RPLP1 is 1 ng/ml as a capture antibody. |
Your cart is empty.