3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11550
Human SH2B monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | AAH10704 |
| Gene Id | 25970 |
| Gene Symbols | SH2B,SH2B1 |
| Protein Name / Synonyms | DKFZp547G1110, FLJ30542, KIAA1299, SH2-B, SH2B |
| Clonality | Monoclonal |
| Immunogen Sequence | GKAKHLRLSLNEEGQCRVQHLWFQSIFDMLEHFRVHPIPL ESGGSSDVVLVSYVPSSQRQQGREQAGSHAGVCEGDGCHP DASCTLMPFGASDCVTDHLP |
| Isotype | Kappa, IgG1 |
| Recommended Applications | Immunofluorescence, ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.63 KDa). |
![]() | Western Blot analysis of SH2B1 expression in transfected 293T cell line by SH2B1 monoclonal antibody. Lane 1: SH2B1 transfected lysate(52.917 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunofluorescence of monoclonal antibody to SH2B1 on HeLa cell. [antibody concentration 10 ug/ml] |
![]() | Detection limit for recombinant GST tagged SH2B is approximately 0.03ng/ml as a capture antibody. |
Your cart is empty.