Human SNAI1 monoclonal antibody (100 ug)
Loading...
Loading...
Loading...
Loading...
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_005976.2 |
| Gene Id | 6615 |
| Gene Symbols | SNAI1 |
| Clonality | Monoclonal |
| Immunogen Sequence | LEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCN KEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVR THTGEKPFSCPHCSRAFADRSNLRAHLQTHdiv class="ty-product-feature__value">Paritally recombinant protein with GST tag. ,MW of the GST tag alone is 26KDa. |
| Isotype | Kappa, IgG1 |
| Concentration (lot specific) | 0.5mg/ml |
| Recommended Applications | Immunoprecipitation, Western Blotting, ELISA |
| Shipping Type | Blue ice |
| Storage | -20°C |
![]() | Western Blot analysis of SNAI1 expression in transfected 293T cell line by SNAI1 monoclonal antibody. Lane 1: SNAI1 transfected lysate(29.1 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunoprecipitation of SNAI1 transfected lysate using anti-SNAI1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with SNAI1 MaxPab rabbit polyclonal antibody. |
![]() | Detection limit for recombinant GST tagged SNAI1 is 0.3 ng/ml as a capture antibody. |
Your cart is empty.
Anti-SNAI1 Antibody
Anti-SNAI1 Antibody