3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11640
Human SP100 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_003104 |
| Gene Id | 6672 |
| Gene Symbols | SP100 |
| Protein Name / Synonyms | DKFZp686E07254, FLJ00340, FLJ34579 |
| Clonality | Monoclonal |
| Immunogen Sequence | MAGGGGDLSTRRLNECISPVANEMNHLPAHSHDLQRMFTE DQGVDDRLLYDIVFKHFKRNKVEISNAIKKTFPFLEGLRD RDLITNKMFEDSQDSCRN |
| Isotype | Kappa, IgG2a |
| Recommended Applications | ELISA, Western Blotting |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (36.52 KDa). |
![]() | Western blot analysis of SP100 over-expressed 293 cell line, cotransfected with SP100 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with SP100 monoclonal antibody. GAPDH ( 36.1 kDa ) used as specificity and loading control. |
![]() | Western Blot analysis of SP100 expression in transfected 293T cell line by SP100 monoclonal antibody. Lane 1: SP100 transfected lysate(100.417 KDa). Lane 2: Non-transfected lysate. |
![]() | Detection limit for recombinant GST tagged SP100 is 0.03 ng/ml as a capture antibody. |
Your cart is empty.