Anti-SP100 Antibody

Product Description

Size	100 µg
Estimated Lead Time	1-2 weeks
Species	Human
Host Species	Mouse
Accession Number	NP_003104
Gene Id	6672
Gene Symbols	SP100
Protein Name / Synonyms	DKFZp686E07254, FLJ00340, FLJ34579
Clonality	Monoclonal
Immunogen Sequence	MAGGGGDLSTRRLNECISPVANEMNHLPAHSHDLQRMFTE DQGVDDRLLYDIVFKHFKRNKVEISNAIKKTFPFLEGLRD RDLITNKMFEDSQDSCRN
Isotype	Kappa, IgG2a
Recommended Applications	ELISA, Western Blotting
Shipping Type	Blue ice
Storage	-20°C
More Information	Specificity Human

DKFZp686E07254, FLJ00340, FLJ34579

Mouse monoclonal antibody raised against a partial recombinant SP100.

Specificity

Human

Gene Accession #

NM_003113

Storage Buffer

1x PBS, pH 7.2

	Western Blot detection against Immunogen (36.52 KDa).
	Western blot analysis of SP100 over-expressed 293 cell line, cotransfected with SP100 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with SP100 monoclonal antibody. GAPDH ( 36.1 kDa ) used as specificity and loading control.
	Western Blot analysis of SP100 expression in transfected 293T cell line by SP100 monoclonal antibody. Lane 1: SP100 transfected lysate(100.417 KDa). Lane 2: Non-transfected lysate.
	Detection limit for recombinant GST tagged SP100 is 0.03 ng/ml as a capture antibody.

Storage Recommendations

Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Expiration:

12 months from the date of shipment when stored properly.

Product Description