Anti-TMEM1 Antibody

Product Description

Size	100 µg
Estimated Lead Time	1-2 weeks
Species	Human
Host Species	Mouse
Accession Number	NP_003265
Gene Id	7109
Gene Symbols	TMEM1,TRAPPC10
Protein Name / Synonyms	EHOC-1, EHOC1, FLJ54223, FLJ54817, FLJ55683, GT334, MGC126777, TMEM1, TRS130, TRS30
Clonality	Monoclonal
Immunogen Sequence	VRLFKYLPHHSAHSSQLDADSWIENDSLSVDKHGDDQPDS SSLKSRGSVHSACSSEHKGLPMPRLQALPAGQVFNSSSGT QVLVIPSQDDHVLEVS
Isotype	Kappa, IgG1
Recommended Applications	ELISA, Western Blotting
Shipping Type	Blue ice
Storage	-20°C
More Information	Specificity Human

EHOC-1, EHOC1, FLJ54223, FLJ54817, FLJ55683, GT334, MGC126777, TMEM1, TRS130, TRS30

Mouse monoclonal antibody raised against a partial recombinant TMEM1.

Specificity

Human

Gene Accession #

NM_003274

Storage Buffer

1x PBS, pH 7.2

	Western Blot detection against Immunogen (36.3 KDa).
	Western blot analysis of TMEM1 over-expressed 293 cell line, cotransfected with TMEM1 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with TMEM1 monoclonal antibody. GAPDH ( 36.1 kDa ) used as specificity and loading control.
	TMEM1 monoclonal antibody Western Blot analysis of TMEM1 expression in Hela NE .
	Western Blot analysis of TMEM1 expression in transfected 293T cell line by TMEM1 monoclonal antibody. Lane 1: TMEM1 transfected lysate(142.2 KDa). Lane 2: Non-transfected lysate.

Storage Recommendations

Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Expiration:

12 months from the date of shipment when stored properly.

Product Description