3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
Catalog #: 101-11978
Human ZNF207 monoclonal antibody (100 ug)
| Size | 100 µg |
| Estimated Lead Time | 1-2 weeks |
| Species | Human |
| Host Species | Mouse |
| Accession Number | NP_003448 |
| Gene Id | 7756 |
| Gene Symbols | ZNF207 |
| Protein Name / Synonyms | DKFZp761N202 |
| Clonality | Monoclonal |
| Immunogen Sequence | MGRKKKKQLKPWCWYCNRDFDDEKILIQHQKAKHFKCHIC HKKLYTGPGLAIHCMQVHKETIDAVPNAIPGRTDIELEIY GMEGIPEKDMDERRRLLEQKTQESQKKKQQ |
| Isotype | Kappa, IgG2a |
| Recommended Applications | Western Blotting, ELISA, Immunofluorescence |
| Shipping Type | Blue ice |
| Storage | -20°C |
| More Information | Specificity Human |
![]() | Western Blot detection against Immunogen (37.84 KDa). |
![]() | ZNF207 monoclonal antibody Western Blot analysis of ZNF207 expression in Hela NE . |
![]() | Western Blot analysis of ZNF207 expression in transfected 293T cell line by ZNF207 monoclonal antibody. Lane 1: ZNF207 transfected lysate(49.7 KDa). Lane 2: Non-transfected lysate. |
![]() | Immunofluorescence of monoclonal antibody to ZNF207 on HeLa cell. [antibody concentration 10 ug/ml] |
Your cart is empty.