3607 Parkway Ln Ste 200 Norcross, Georgia 30092
www.RayBiotech.com | info@raybiotech.com
770-729-2992 | +1-888-494-8555
ISO 13485:2016 cGMP
High-Mobility Group Box 1, Human Recombinant
Catalog #: 228-10767
Product Description
Specifications
| Size | 50 µg, 1000 µg |
| Estimated Lead Time | 2-3 weeks |
| Species | Human |
| Accession Number | P09429 |
| Gene Id | 3146 |
| Protein Name / Synonyms | HMG1, HMG3, SBP-1, Amphoterin, HMGB1, High-Mobility Group Box 1. |
| Expressed Region | MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDELEHHHHHH. |
| Expression System | E. coli |
| Purity | Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Format | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation | The HMG1 (1 mg/ml) was lyophilized after extensive dialyses against 1x PBS pH-7.4. |
| Research Area | Angiogenesis, Cancer, Inflammation, Autophagy |
| Shipping Type | Ambient temperature |
| Storage | -20°C |
Description
Description
HMG1 Human Recombinant fused with 6X His tag produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 223 amino acids and having a molecular mass of 26 kDa.The HMGB-1 is purified by proprietary chromatographic techniques.
Stability & Storage
Storage/Stability
Lyophilized HMGB1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution HMGB1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.