See description below for image caption

Mouse Anti-Human ACVR1B

Human ACVR1B monoclonal antibody (100 ug)

$412.00  
101-10023
+

Antigen Information

Accession Number:
  • AAH00254
Gene ID:
  • 91
Gene Symbols:
  • ACVR1B
Protein Name & Synonyms:
ACVR1B
Target Species:
  • Human

Antibody Specifications

Applications:
WB, Proximity Ligation Analysis, ELISA
Host Species:
Mouse
Immunogen Sequence:
SGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGME HHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNR IDLRVPSGHLKEPEHPSMWGPVE
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG1 Kappa

Synonyms

ACTRIB, ACVRLK4, ALK4, SKR2

Description

Mouse monoclonal antibody raised against a partial recombinant ACVR1B.

Source

Specificity
Human

Gene Information

Gene Accession #
BC000254

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (36.96 KDa).
Western Blot analysis of ACVR1B expression in transfected 293T cell line by ACVR1B monoclonal antibody. Lane 1: ACVR1B transfected lysate (Predicted MW: 56.8 KDa). Lane 2: Non-transfected lysate.
Proximity Ligation Analysis of protein-protein interactions between XIAP and ACVR1B HeLa cells were stained with anti-XIAP rabbit purified polyclonal 1:1200 and anti-ACVR1B mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Detection limit for recombinant GST tagged ACVR1B is approximately 0.03ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.