Mouse Anti-Human AXIN2

Human AXIN2 monoclonal antibody (100 ug)

101-10138
+

Antigen Information

Accession Number:
  • NP_004646
Gene ID:
  • 8313
Gene Symbols:
  • AXIN2
Protein Name & Synonyms:
AXIN2
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA, WB
Host Species:
Mouse
Immunogen Sequence:
EEGDRSQDVWQWMLESERQSKPKPHSAQSTKKAYPLESAR SSPGERASRHHLWGGNSGHPRTTPRAHLFTQDPAMPPLTP PNTLAQLEEACRRLAEVSKP
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG1 Kappa

Synonyms

AXIL, DKFZp781B0869, MGC10366, MGC126582

Description

Mouse monoclonal antibody raised against a partial recombinant AXIN2.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_004655

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (36.74 KDa).
Detection limit for recombinant GST tagged AXIN2 is 0.3 ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.