Mouse Anti-Human CCNT2

Human CCNT2 monoclonal antibody (100 ug)

$412.00
101-10236
+

Antigen Information

Accession Number:
  • NP_490595
Gene ID:
  • 905
Gene Symbols:
  • CCNT2
Protein Name & Synonyms:
CCNT2
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA, WB
Host Species:
Mouse
Immunogen Sequence:
RKPKVDGQVSETPLLGSSLVQNSILVDSVTGVPTNPSFQK PSTSAFPAPVPLNSGNISVQDSHTSDNLSMLATGMPSTSY GLSSHQEWPQHQDSARTEQLYSQKQET
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2a Kappa

Synonyms

FLJ90560, MGC134840

Description

Mouse monoclonal antibody raised against a partial recombinant CCNT2.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_058241

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (37.51 KDa).
CCNT2 monoclonal antibody Western Blot analysis of CCNT2 expression in Jurkat.
Detection limit for recombinant GST tagged CCNT2 is 0.3 ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.