Mouse Anti-Human DDIT3

Human DDIT3 monoclonal antibody (100 ug)

$412.00
101-10386
+

Antigen Information

Accession Number:
  • AAH03637
Gene ID:
  • 1649
Gene Symbols:
  • DDIT3
Protein Name & Synonyms:
DDIT3
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA, WB
Host Species:
Mouse
Immunogen Sequence:
MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVS PPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSP HSPDSSQSSL
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG1 Kappa

Synonyms

CEBPZ, CHOP, CHOP10, GADD153, MGC4154

Description

Mouse monoclonal antibody raised against a partial recombinant DDIT3.

Source

Specificity
Human

Gene Information

Gene Accession #
BC003637

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (35.53 KDa).
Detection limit for recombinant GST tagged DDIT3 is approximately 0.03ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.