1-888-494-8555

5% Off All Online Orders

Mouse Anti-Human HBEGF

$412.00
101-10693


Human HBEGF monoclonal antibody (100 ug)

+

Synonyms

DTR, DTS, DTSF, HEGFL

Description

Mouse monoclonal antibody raised against a full length recombinant HBEGF.

Source

Specificity
Human
Host
Mouse
Isotype
IgG1 Kappa
Immunogen Sequence
LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDR KVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGK GLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYH GERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIV GLLMFRYHRRGGYDVENEEKVKLGMTNSH
Protein Accession #
AAH33097.1

Gene Information

Gene Name
HBEGF
GeneID
1839
Gene Accession #
BC033097

Preparation

Storage Buffer
1x PBS, pH 7.2
Applications
ELISA

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Antigen Information

Gene Symbol:
  • HBEGF
Target Species:
Human

Product Specifications

Size:
100 ug

Antibody Specifications

Host Species:
Mouse
Clonality:
Monoclonal
Isotype:
IgG1 Kappa
Write A Review

No posts found

U.S. International

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.

Cart content Cart content