Mouse Anti-Human HMBS

Human HMBS monoclonal antibody (100 ug)

$412.00
101-10722
+

Antigen Information

Accession Number:
  • AAH00520.1
Gene ID:
  • 3145
Gene Symbols:
  • HMBS
Protein Name & Synonyms:
HMBS
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA, WB
Host Species:
Mouse
Immunogen Sequence:
MSGNGNAAATAEENSPKMRVIRVGTRKSQLARIQTDSVVA TLKASYPGLQFEIIAMSTTGDKIPDTALSKIGEKSLFTKE LEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPH DAVVFHPKFVGKTLETLPEKSVVGTSSLRRAAQLQRKFPH LEFRSIRGNLNTRLRKLDEQQEFSAIILATAGLQRMGWHN RVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHD PETLLRCIAERAFLRHLEGGCSVPVAVHTAMKDGQLYLTG GVWSLDGSDSIQETMQATIHVPAQHEDGPEDDPQLVGITA RNIPRGPQLAAQNLGISLANLLLSKGAKNILDVARQLNDA H
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2a Kappa

Synonyms

PBG-D, PBGD, UPS

Description

Mouse monoclonal antibody raised against a full length recombinant HMBS.

Source

Specificity
Human

Gene Information

Gene Accession #
BC000520

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (65.45 KDa).
Western Blot analysis of HMBS expression in transfected 293T cell line by HMBS monoclonal antibody. Lane 1: HMBS transfected lysate(39.71 KDa). Lane 2: Non-transfected lysate.
Detection limit for recombinant GST tagged HMBS is approximately 1ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.