Mouse Anti-Human MCPH1

Human MCPH1 monoclonal antibody (100 ug)

$412.00
101-10974
+

Antigen Information

Accession Number:
  • NP_078872
Gene ID:
  • 79648
Gene Symbols:
  • MCPH1
Protein Name & Synonyms:
MCPH1
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA, WB
Host Species:
Mouse
Immunogen Sequence:
ATSSCVTSAPEEALRCCRQAGKEDACPEGNGFSYTIEDPA LPKGHDDDLTPLEGSLEEMKEAVGLKSTQNKGTTSKISNS SEGEAQSEH
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG1 Kappa

Synonyms

BRIT1, FLJ12847, MCT

Description

Mouse monoclonal antibody raised against a partial recombinant MCPH1.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_024596

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (35.53 KDa).

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.