Mouse Anti-Human MPP2

Human MPP2 monoclonal antibody (100 ug)

$412.00
101-11015
+

Antigen Information

Accession Number:
  • AAH30287
Gene ID:
  • 4355
Gene Symbols:
  • MPP2
Protein Name & Synonyms:
MPP2
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA, Immunoprecipitation
Host Species:
Mouse
Immunogen Sequence:
MPVAATNSETAMQQVLDNLGSLPSATGAAELDLIFLRGIM ESPIVRSLAKAHERLEETKLEAVRDNNLELVQEILRDLAQ LAEQSSTAAELAHILQEPHFQSLLETHDSVASKTYETPPP SPGLDPTFSNQPVPPDAVRMVGIRKTAGEHLGVTFRVEGG ELVIARILHGGMVAQQGLLHVGDIIKEVNGQPVGSDPRAL QELLRNASGSVILKILPSYQEPHLPRQVFVKCHFDYDPAR DSLIPCKEAGLRFNAGDLLQIVNQDDANWWQACHVEGGSA GLIPSQLLEEKRKAFVKRDLELTPNSGTLCGSLSGKKKKR MMYLTTKNAEFDRHELLIYEEVARMPPFRRKTLVLIGAQG VGRRSLKNKLIMWDPDRYGTTVPYTSRRPKDSEREGQGYS FVSRGEMEADVRAGRYLEHGEYEGNLYGTRIDSIRGVVAA GKVCVLDVNPQAVKVLRTAEFVPYVVFIEAPDFETLRAMN RAALESGISTKQLTEADLRRTVEESSRIQRGYGHYFDLCL VNSNLERTFRELQTAMEKLRTEPQWVPVSWVY
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG1 Kappa

Synonyms

DKFZp686A06252, DKFZp686J2189, DKFZp761D0712, DLG2

Description

Mouse monoclonal antibody raised against a full-length recombinant MPP2.

Source

Specificity
Human

Gene Information

Gene Accession #
BC030287

Preparation

Storage Buffer
1x PBS, pH 7.2

Immunoprecipitation of MPP2 transfected lysate using anti-MPP2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with MPP2 MaxPab rabbit polyclonal antibody.
Detection limit for recombinant GST tagged MPP2 is 1 ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.