Mouse Anti-Human NAPSA

Human NAPSA monoclonal antibody (100 ug)

$412.00
101-11067
+

Antigen Information

Accession Number:
  • AAH17842
Gene ID:
  • 9476
Gene Symbols:
  • NAPSA
Protein Name & Synonyms:
NAPSA
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA
Host Species:
Mouse
Immunogen Sequence:
LIRIPLHRVQPGRRTLNLLRGWREPAELPKLGAPSPGDKP IFVPLSNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNLWVP SRRCHFFSVPCWLHHRFDPKASSSFQANGTKFAIQYGTGR VDGILSEDKLTIGGIKGASVIFGEALWEPSLVFAFAHFDG ILGLGFPILSVEGVRPPMDVLVEQGLLDKPVFSFYLNRDP EEPDGGELVLGGSDPAHYIPPLTFVPVTVPAYWQIHMERV KVGPGLTLCAKGCAAILDTGTSLITGPTEEIRALHAAIGG IPLLAGEYIILCSEIPKLPAVSFLLGGVWFNLTAHDYVIQ TTRNGVRLCLSGFQALDVPPPAGPFWILGDVFLGTYVAVF DRGDMKSSARVGLARARTRGADLGWGETAQAQFPG
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2b Kappa

Synonyms

KAP, Kdap, NAP1, NAPA, SNAPA

Description

Mouse monoclonal antibody raised against a full-length recombinant NAPSA.

Source

Specificity
Human

Gene Information

Gene Accession #
BC017842

Preparation

Storage Buffer
1x PBS, pH 7.2

Detection limit for recombinant GST tagged NAPSA is 0.3 ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.