Mouse Anti-Human NELL1

Human NELL1 monoclonal antibody (100 ug)

$412.00
101-11088
+

Antigen Information

Accession Number:
  • NP_006148
Gene ID:
  • 4745
Gene Symbols:
  • NELL1
Protein Name & Synonyms:
NELL1
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA
Host Species:
Mouse
Immunogen Sequence:
CRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLA EGQRILTKSCRECRGGVLVKITEMCPPLNCSEKDHILPEN QCCRVCRGHNFCAEGPKCGE
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2a Kappa

Synonyms

FLJ45906, IDH3GL, NRP1

Description

Mouse monoclonal antibody raised against a partial recombinant NELL1.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_006157

Preparation

Storage Buffer
1x PBS, pH 7.2

Detection limit for recombinant GST tagged NELL1 is approximately 1ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.