Mouse Anti-Human NOS2

Human NOS2 monoclonal antibody (100 ug)

$412.00
101-11123
+

Antigen Information

Accession Number:
  • NP_000616
Gene ID:
  • 4843
Gene Symbols:
  • NOS2
Protein Name & Synonyms:
NOS2, HEP-NOS, INOS, NOS, NOS2A
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA, WB
Buffer:
In 1x PBS, pH 7.4
Clone:
2G4
Concentration:
0.5 mg/ml
Host Species:
Mouse
Immunogen Sequence:
DVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDLSKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQPALVQGILERVVDG
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG1 Kappa

Description

Mouse monoclonal antibody raised against a partial recombinant NOS2.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_000625
Western Blot detection against Immunogen (37.84 KDa).
Detection limit for recombinant GST tagged NOS2 is 0.3 ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.