Mouse Anti-Human NR2F1

Human NR2F1 monoclonal antibody (100 ug)

$412.00
101-11135
+

Antigen Information

Accession Number:
  • AAH04154.1
Gene ID:
  • 7025
Gene Symbols:
  • NR2F1
Protein Name & Synonyms:
NR2F1
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA, WB
Host Species:
Mouse
Immunogen Sequence:
CRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLN GHCYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENIC ELAARLLFSAVEWARNIPFF
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2a Kappa

Synonyms

COUP-TFI, EAR-3, EAR3, ERBAL3, NR2F2, SVP44, TCFCOUP1, TFCOUP1

Description

Mouse monoclonal antibody raised against a partial recombinant NR2F1.

Source

Specificity
Human

Gene Information

Gene Accession #
BC004154

Preparation

Storage Buffer
1x PBS, pH 7.2

NR2F1 monoclonal antibody Western Blot analysis of NR2F1 expression in human placenta.
Detection limit for recombinant GST tagged NR2F1 is 1 ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.