Mouse Anti-Human NR2F2

Human NR2F2 monoclonal antibody (100 ug)

$412.00
101-11136
+

Antigen Information

Accession Number:
  • NP_066285
Gene ID:
  • 7026
Gene Symbols:
  • NR2F2
Protein Name & Synonyms:
NR2F2
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA
Host Species:
Mouse
Immunogen Sequence:
RMPPTQPTHGQFALTNGDPLNCHSYLSGYISLLLRAEPYP TSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPF FPDLQITD
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2b Kappa

Synonyms

ARP1, COUP-TFII, COUPTFB, MGC117452, SVP40, TFCOUP2

Description

Mouse monoclonal antibody raised against a partial recombinant NR2F2.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_021005

Preparation

Storage Buffer
1x PBS, pH 7.2

Detection limit for recombinant GST tagged NR2F2 is approximately 1ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.