Mouse Anti-Human PLCL2

Human PLCL2 monoclonal antibody (100 ug)

$412.00  
101-11276
+

Antigen Information

Accession Number:
  • AAH36392
Gene ID:
  • 23228
Gene Symbols:
  • PLCL2
Protein Name & Synonyms:
PLCL2
Target Species:
  • Human

Antibody Specifications

Applications:
WB, Immunoprecipitation, ELISA
Host Species:
Mouse
Immunogen Sequence:
RYLISYGKHTLDMLESSQDNMRTSWVSQMFSEIDVDNLGH ITLCNAVQCIRNLNPGLKTSKIELKFKELHKSKDKAGTEV TKEEFIEVFH
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2a Kappa

Synonyms

FLJ13484, KIAA1092, PLCE2

Description

Mouse monoclonal antibody raised against a partial recombinant PLCL2.

Source

Specificity
Human

Gene Information

Gene Accession #
BC036392

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (35.64 KDa).
Western Blot analysis of PLCL2 expression in transfected 293T cell line by PLCL2 monoclonal antibody. Lane 1: PLCL2 transfected lysate (Predicted MW: 113.7 KDa). Lane 2: Non-transfected lysate.
Immunoprecipitation of PLCL2 transfected lysate using anti-PLCL2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PLCL2 monoclonal antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.