Mouse Anti-Human pp9099

Human pp9099 monoclonal antibody (100 ug)

$412.00
101-11295
+

Antigen Information

Accession Number:
  • NP_079477
Gene ID:
  • 80301
Gene Symbols:
  • PLEKHO2
Protein Name & Synonyms:
pp9099
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA, WB
Host Species:
Mouse
Immunogen Sequence:
GDLLGEGPRHPLQPRERLYRAQLEVKVASEQTEKLLNKVL GSEPAPVSAETLLSQAVEQLRQATQVLQEMRDLGELSQEA PGLREKRKELVTLYRRSAP
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG1 Kappa

Synonyms

DKFZp761K2312, FLJ38884, PLEKHQ1, PP1628, pp9099

Description

Mouse monoclonal antibody raised against a partial recombinant pp9099.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_025201

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (36.63 KDa).
pp9099 monoclonal antibody Western Blot analysis of pp9099 expression in Jurkat .
Detection limit for recombinant GST tagged pp9099 is approximately 0.03ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.