Mouse Anti-Human PSMD10

Human PSMD10 monoclonal antibody (100 ug)

$412.00
101-11344
+

Antigen Information

Accession Number:
  • AAH11960
Gene ID:
  • 5716
Gene Symbols:
  • PSMD10
Protein Name & Synonyms:
PSMD10
Target Species:
  • Human

Antibody Specifications

Applications:
WB, ELISA
Host Species:
Mouse
Immunogen Sequence:
MEGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDS RTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLHIA ASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHE IAVMLLEGGANPDAKDHYEATAMHRAAAKGNLKMIHILLY YKASTNIQDTEGNTPLHLACDEERVEEAKLLVSQGASIYI ENKEEKTPLQVAKGGLGLILKRMVEG
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG1 Kappa

Synonyms

dJ889N15.2, p28

Description

Mouse monoclonal antibody raised against a full-length recombinant PSMD10.

Source

Specificity
Human

Gene Information

Gene Accession #
BC011960

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (50.6 KDa).
Western Blot analysis of PSMD10 expression in transfected 293T cell line by PSMD10 monoclonal antibody . Lane 1: PSMD10 transfected lysate(24.4 KDa). Lane 2: Non-transfected lysate.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.