Mouse Anti-Human PTK7

Human PTK7 monoclonal antibody (100 ug)

$412.00  
101-11353
+

Antigen Information

Accession Number:
  • NP_002812
Gene ID:
  • 5754
Gene Symbols:
  • PTK7
Protein Name & Synonyms:
PTK7
Target Species:
  • Human

Antibody Specifications

Applications:
ELISA, WB
Host Species:
Mouse
Immunogen Sequence:
KQPSSQDALQGRRALLRCEVEAPGPVHVYWLLDGAPVQDT ERRFAQGSSLSFAAVDRLQDSGTFQCVARDDVTGEEARSA NASFNIKWIEAGPVVLKHPASEAEIQPQTQ
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2b Kappa

Synonyms

CCK4

Description

Mouse monoclonal antibody raised against a partial recombinant PTK7.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_002821

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (37.84 KDa).
PTK7 monoclonal antibody Western Blot analysis of PTK7 expression in HeLa .
Detection limit for recombinant GST tagged PTK7 is approximately 3ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.