Mouse Anti-Human TMPRSS5

Human TMPRSS5 monoclonal antibody (100 ug)

$412.00  
101-11806
+

Antigen Information

Accession Number:
  • NP_110397.1
Gene ID:
  • 80975
Gene Symbols:
  • TMPRSS5
Protein Name & Synonyms:
TMPRSS5
Target Species:
  • Human

Antibody Specifications

Applications:
WB, ELISA
Host Species:
Mouse
Immunogen Sequence:
HCMHSFRLARLSSWRVHAGLVSHSAVRPHQGALVERIIPH PLYSAQNHDYDVALLRLQTALNFSDTVGAVCLPAKEQHFP KGSRCWVSGWGHTHPSHTYS
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG1 Kappa

Synonyms

MGC141886, MGC148044, SPINESIN

Description

Mouse monoclonal antibody raised against a partial recombinant TMPRSS5.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_030770

Preparation

Storage Buffer
1x PBS, pH 7.2

TMPRSS5 monoclonal antibody Western Blot analysis of TMPRSS5 expression in human kidney.
Western Blot analysis of TMPRSS5 expression in transfected 293T cell line by TMPRSS5 monoclonal antibody. Lane 1: TMPRSS5 transfected lysate (Predicted MW: 49.6 KDa). Lane 2: Non-transfected lysate.
Detection limit for recombinant GST tagged TMPRSS5 is 3 ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.