Mouse Anti-Human TRAF3

Human TRAF3 monoclonal antibody (100 ug)

$412.00
101-11834
+

Antigen Information

Accession Number:
  • NP_663777
Gene ID:
  • 7187
Gene Symbols:
  • TRAF3
Protein Name & Synonyms:
TRAF3
Target Species:
  • Human

Antibody Specifications

Applications:
Proximity Ligation Analysis, ELISA, WB
Host Species:
Mouse
Immunogen Sequence:
FEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEI RPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARN TGLLESQLSRHDQMLSVHDIRLADMDLRFQVLE
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2a Kappa

Synonyms

CAP-1, CD40bp, CRAF1, LAP1

Description

Mouse monoclonal antibody raised against a partial recombinant TRAF3.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_145725

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (38.17 KDa).
Proximity Ligation Analysis of protein-protein interactions between TRAF5 and TRAF3 HeLa cells were stained with anti-TRAF5 rabbit purified polyclonal 1:1200 and anti-TRAF3 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.