Mouse Anti-Human TRIM47

Human TRIM47 monoclonal antibody (100 ug)

$412.00  
101-11845
+

Antigen Information

Accession Number:
  • NP_258411
Gene ID:
  • 91107
Gene Symbols:
  • TRIM47
Protein Name & Synonyms:
TRIM47
Target Species:
  • Human

Antibody Specifications

Applications:
Immunofluorescence, ELISA, WB
Host Species:
Mouse
Immunogen Sequence:
PLPHPFSPTVGVCLEYADRALAFYAVRDGKMSLLRRLKAS RPRRGGIPASPIDPFQSRLDSHFAGLFTHRLKPAFFLESV DAHLQIGPLKKSCISVLKRR
Species Reactivity:
Human
Clonality:
Monoclonal
Isotype:
IgG2a Kappa

Synonyms

GOA, RNF100

Description

Mouse monoclonal antibody raised against a partial recombinant TRIM47.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_033452

Preparation

Storage Buffer
1x PBS, pH 7.2

TRIM47 monoclonal antibody Western Blot analysis of TRIM47 expression in human placenta.
TRIM47 monoclonal antibody Western Blot analysis of TRIM47 expression in Hela NE.
Immunofluorescence of monoclonal antibody to TRIM47 on HeLa cell. [antibody concentration 10 ug/ml]
Detection limit for recombinant GST tagged TRIM47 is 1 ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

No posts found

Write A Review

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.