Human ABTB1 monoclonal antibody (100 ug)
$376.00
In stock
Code:
101-10012
-
+

Product Description

Specifications

Size 100 ug
Protein Name / Synonyms BPOZ, Btb3, EF1ABP, MGC20585, PP2259
Accession Number NP_742024
Gene Symbols ABTB1
Gene Id 80325
Applications ELISA
Isotype kappa, Igg2a
Immunogen Sequence CPDICFRVAGCSFLCHKAFFCGRSDYFRALLDDHFRESEE PATSGGPPAVTLHGISPDVFTHVLYYMYSDHTELSPEAAY DVLSVADMYLLPGLKRLCGR
More Information Specificity

Human
Host Species Mouse
Clonality Monoclonal
Species Human

Synonyms

BPOZ, Btb3, EF1ABP, MGC20585, PP2259

Description

Mouse monoclonal antibody raised against a partial recombinant ABTB1.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_172027

Preparation

Storage Buffer
1x PBS, pH 7.2

Detection limit for recombinant GST tagged ABTB1 is approximately 0.03ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
Write Your Own Review
Your Rating
Submit a more detailed review for this product on Biocompare.com to receive an additional $20 Amazon gift card!

Ask a Question

Display name:
Your location:*