Protein Name & Synonyms:
AMH
This product is specific for human anti-mullerian hormone (AMH), originally classified as a fetal testicular hormone that inhibits Mullerian duct development. AMH is expressed post-natally by immature Sertoli cells, and to a lesser degree by granulosa cells. AMH plays a role in testicular differentiation and in the regulation of ovarian follicle growth.
AMH is a member of the TGF beta superfamily. It is secreted as a homodimeric 140kD disulphide linked precursor that is cleaved to release the mature 30kD homodimer.
Store at +4 °C or at -20 °C if preferred.
This product should be stored undiluted.
Storage in frost-free freezers is not recommended. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
If stored in this manner, this product is stable for 18 months after receipt.
Supplied as:
Concentrated Tissue Culture Supernatant - liquid
Immunogen:
Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC)
This product
Spleen cells from immunised T/O outbred mice were fused with cells of the SP2/0 myeloma cell line.