1-888-494-8555

Mouse Anti-Human AMH

Mouse Anti-Human AMH

Contact your local distributor
DS-MB-02769
+ −
Add to comparison list

Antigen Information

Protein Name & Synonyms:
AMH
Target Species:
  • Human

Specificity

This product is specific for human anti-mullerian hormone (AMH), originally classified as a fetal testicular hormone that inhibits Mullerian duct development. AMH is expressed post-natally by immature Sertoli cells, and to a lesser degree by granulosa cells. AMH plays a role in testicular differentiation and in the regulation of ovarian follicle growth.

AMH is a member of the TGF beta superfamily. It is secreted as a homodimeric 140kD disulphide linked precursor that is cleaved to release the mature 30kD homodimer.

Storage/Stability

Store at +4 °C or at -20 °C if preferred.

This product should be stored undiluted.

Storage in frost-free freezers is not recommended. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
If stored in this manner, this product is stable for 18 months after receipt.

Format

Supplied as:
Concentrated Tissue Culture Supernatant - liquid
Format Type:
Con S/N

Preparation

Immunogen:
Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC)
Preservative:
0.09%Sodium Azide
This product
Spleen cells from immunised T/O outbred mice were fused with cells of the SP2/0 myeloma cell line.

No posts found

Write A Review
U.S. Non-U.S.

Usage

This product is furnished for LABORATORY RESEARCH USE ONLY.
Not for diagnostic or therapeutic use.