Human ANXA10 monoclonal antibody (100 ug)
$376.00
In stock
Code:
101-10083
-
+

Product Description

Specifications

Size 100 ug
Protein Name / Synonyms ANX14
Accession Number AAH07320
Gene Symbols ANXA10
Gene Id 11199
Applications ELISA
Isotype kappa, Igg2b
Immunogen Sequence MFCGDYVQGTIFPAPNFNPIMDAQMLGGALQGFDCDKDML INILTQRCNAQRMMIAEAYQSMYGRDLIGDMREQLSDHFK DVMAGLMYPPPLYDAHELWHAMKGVGTDENCLIEILASRT NGEIFQMREAYCLQYSNNLQEDIYSETSGHFRDTLMNLVQ GTREEGYTDPAMAAQDAMVLWEACQQKTGEHKTMLQMILC NKSYQQLRLVFQEFQNISGQDMVDAINECYDGYFQELLVA IVLCVRDKPAYFAYRLYSAIHDFGFHNKTVIRILIARSEI DLLTIRKRYKERYGKSLFHDIRNFASGHYKKALLAICAGD AEDY
Gene Names ANXA10
More Information Specificity

Human
Host Species Mouse
Clonality Monoclonal
Species Human

Synonyms

ANX14

Description

Mouse monoclonal antibody raised against a full length recombinant ANXA10.

Source

Specificity
Human

Gene Information

Gene Accession #
BC007320

Preparation

Storage Buffer
1x PBS, pH 7.2

ANXA10 monoclonal antibody. Western Blot analysis of ANXA10 expression in human placenta.
Detection limit for recombinant GST tagged ANXA10 is approximately 0.03ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
Write Your Own Review
Your Rating
Submit a more detailed review for this product on Biocompare.com to receive an additional $20 Amazon gift card!

Ask a Question

Display name:
Your location:*