Mouse Anti-Human ATP6V1B2

Human ATP6V1B2 monoclonal antibody (100 ug)
$376.00
In stock
Code:
101-10132
-
+

Product Description

Specifications

Size 100 ug
Protein Name / Synonyms ATP6B1B2, ATP6B2, HO57, VATB, VPP3, Vma2
Accession Number AAH03100
Gene Symbols ATP6V1B2
Gene Id 526
Applications ELISA
Isotype kappa, Igg2b
Immunogen Sequence MALRAMRGIVNGAAPELPVPTGGPAVGAREQALAVSRNYL SQPRLTYKTVSGVNGPLVILDHVKFPRYAEIVHLTLPDGT KRSGQVLEVSGSKAVVQVFEGTSGIDAKKTSCEFTGDILR TPVSEDMLGRVFNGSGKPIDRGPVVLAEDFLDIMGQPINP QCRIYPEEMIQTGISAIDGMNSIARGQKIPIFSAAGLPHN EIAAQICRQAGLVKKSKDVVDYSEENFAIVFAAMGVNMET ARFFKSDFEENGSMDNVCLFLNLANDPTIERIITPRLALT TAEFLAYQCEKHVLVILTDMSSYAEALREVSAAREEVPGR RGFPGYMYTDLATIYERAGRVEGRNGSITQIPILTMPNDD ITHPIPDLTGYITEGQIYVDRQLHNRQIYPPINVLPSLSR LMKSAIGEGMTRKDHADVSNQLYACYAIGKDVQAMKAVVG EEALTSDDLLYLEFLQKFERNFIAQGPYENRTVFETLDIG WQLLRIFPKEMLKRIPQSTLSEFYPRDSAKH
Gene Names ATP6V1B2
More Information Specificity

Human
Host Species Mouse
Clonality Monoclonal
Species Human

Synonyms

ATP6B1B2, ATP6B2, HO57, VATB, VPP3, Vma2

Description

Mouse monoclonal antibody raised against a full length recombinant ATP6V1B2.

Source

Specificity
Human

Gene Information

Gene Accession #
BC003100

Preparation

Storage Buffer
1x PBS, pH 7.2

Detection limit for recombinant GST tagged ATP6V1B2 is approximately 0.03ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
Write Your Own Review
Your Rating
Submit a more detailed review for this product on Biocompare.com to receive an additional $20 Amazon gift card!

Ask a Question

Display name:
Your location:*