Human DDX54 monoclonal antibody (100 ug)
$376.00
In stock
Code:
101-10389
-
+

Product Description

Specifications

Size 100 ug
Protein Name / Synonyms DP97, MGC2835
Accession Number NP_076977
Gene Symbols DDX54
Gene Id 79039
Applications WB, ELISA, IHC, IF
Isotype kappa, Igg2a
Immunogen Sequence DDRDSDEEGASDRRGPERRGGKRDRGQGASRPHAPGTPAG RVRPELKTKQQILKQRRRAQKLHFLQRGGLKQLSARNRRR VQELQQGAFGRGARSKKGKMRKRM
More Information Specificity

Human
Host Species Mouse
Clonality Monoclonal
Species Human

Synonyms

DP97, MGC2835

Description

Mouse monoclonal antibody raised against a partial recombinant DDX54.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_024072

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (37.18 KDa).
DDX54 monoclonal antibody Western Blot analysis of DDX54 expression in HeLa .
Western Blot analysis of DDX54 expression in transfected 293T cell line by DDX54 monoclonal antibody. Lane 1: DDX54 transfected lysate(98.6 KDa). Lane 2: Non-transfected lysate.
Immunoperoxidase of monoclonal antibody to DDX54 on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma. [antibody concentration 3 ug/ml]
Immunofluorescence of monoclonal antibody to DDX54 on HeLa cell. [antibody concentration 10 ug/ml]
Detection limit for recombinant GST tagged DDX54 is 0.03 ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
Write Your Own Review
Your Rating
Submit a more detailed review for this product on Biocompare.com to receive an additional $20 Amazon gift card!

Ask a Question

Display name:
Your location:*