Human DIP2A monoclonal antibody (100 ug)
$376.00
In stock
Code:
101-10400
-
+

Product Description

Specifications

Size 100 ug
Protein Name / Synonyms C21orf106, DIP2
Accession Number NP_055966
Gene Symbols DIP2A
Gene Id 23181
Applications WB, ELISA
Isotype kappa, Igg2a
Immunogen Sequence KYKERKMPMPSKRRSVLVHSSVETYTPPDTSSASEDEGSL RRPGRLTSTPLQSHSSVEPWLDRVIQGSSTSSSASSTSSH PGGRPTTAPSAAATPGAAATTALAGLEAHTHIDLHSAPPD VTTGLVEHSYFERPQVASVRSVPRGCSGSMLETADGVPVN SRVSSKIQQLLNTLKRPKRPPLKEFFVDDFEELLE
More Information Specificity

Human
Host Species Mouse
Clonality Monoclonal
Species Human

Synonyms

C21orf106, DIP2

Description

Mouse monoclonal antibody raised against a partial recombinant DIP2A.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_015151

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (47.275 KDa).
Western Blot analysis of DIP2A expression in transfected 293T cell line by DIP2A monoclonal antibody. Lane 1: DIP2A transfected lysate (Predicted MW: 170.3 KDa). Lane 2: Non-transfected lysate.
Detection limit for recombinant GST tagged DIP2A is 0.3 ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
Write Your Own Review
Your Rating
Submit a more detailed review for this product on Biocompare.com to receive an additional $20 Amazon gift card!

Ask a Question

Display name:
Your location:*