Human ENC1 monoclonal antibody (100 ug)
$376.00
In stock
Code:
101-10462
-
+

Product Description

Specifications

Size 100 ug
Protein Name / Synonyms CCL28, ENC-1, FLJ39259, KLHL35, KLHL37, NRPB, PIG10, TP53I10
Accession Number NP_003624
Gene Symbols ENC1
Gene Id 8507
Applications WB, ELISA
Isotype kappa, Igg1
Immunogen Sequence SINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLHAGNRT FPCHRAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPE VL
Gene Names ENC1
More Information Specificity

Human
Host Species Mouse
Clonality Monoclonal
Species Human

Synonyms

CCL28, ENC-1, FLJ39259, KLHL35, KLHL37, NRPB, PIG10, TP53I10

Description

Mouse monoclonal antibody raised against a partial recombinant ENC1.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_003633

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (34.76 KDa).
ENC1 monoclonal antibody Western Blot analysis of ENC1 expression in IMR-32 .
Detection limit for recombinant GST tagged ENC1 is approximately 0.3ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
Write Your Own Review
Your Rating
Submit a more detailed review for this product on Biocompare.com to receive an additional $20 Amazon gift card!

Ask a Question

Display name:
Your location:*