Human ERCC6L monoclonal antibody (100 ug)
$376.00
In stock
Code:
101-10483
-
+

Product Description

Specifications

Size 100 ug
Protein Name / Synonyms FLJ20105, MGC131695, PICH
Accession Number AAH08808
Gene Symbols ERCC6L
Gene Id 54821
Applications WB, ELISA
Isotype kappa, Igg2a
Immunogen Sequence MEKSFATKNEAVQKETLQEGPKQEALQEDPLESFNYVLSK STKADIGPNLDQLKDDEILRHCNPWPIISITNESQNAESN VSIIEIADDLSASHSALQDAQASEAKLEEEPSASSPQYAC DFNLFLEDSADNRQNFSSQSLEHVEKENSLCGSAPNSRAG FVHSKTCLSWEFSEKDDEPEEVVVKAKIRSKARRIVSDGE DEDDSFKDTSSINPFNTSLFQFSSVKQFDASTPKNDISPP GRFFSSQIPSSVNKSMNSRRSLASRRSLINMVLDHVEDME ERLDDSSEAKGPEDYPEEGVEESSGEASKYTEEDPSGETL SSENKSSWLMTSKPSALAQETSLGAPEPLSGEQLVGSPQD KAAEATNDYETLVKRGKELKECGKIQEALNCLVKALDIKS ADPEVMLLTLSLYKQLNNN
More Information Specificity

Human
Host Species Mouse
Clonality Monoclonal
Species Human

Synonyms

FLJ20105, MGC131695, PICH

Description

Mouse monoclonal antibody raised against a full length recombinant ERCC6L.

Source

Specificity
Human

Gene Information

Gene Accession #
BC008808

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (71.61 KDa).
Western Blot analysis of ERCC6L expression in transfected 293T cell line by ERCC6L monoclonal antibody -2B10. Lane 1: ERCC6L transfected lysate(46.2 KDa). Lane 2: Non-transfected lysate.
Detection limit for recombinant GST tagged ERCC6L is approximately 0.03ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
Write Your Own Review
Your Rating
Submit a more detailed review for this product on Biocompare.com to receive an additional $20 Amazon gift card!

Ask a Question

Display name:
Your location:*