Human FOXM1 monoclonal antibody (100 ug)
$376.00
In stock
Code:
101-10565
-
+

Product Description

Specifications

Size 100 ug
Protein Name / Synonyms FKHL16, FOXM1B, HFH-11, HFH11, HNF-3, INS-1, MPHOSPH2, MPP-2, MPP2, PIG29, TGT3, TRIDENT
Accession Number NP_973731
Gene Symbols FOXM1
Gene Id 2305
Applications WB, ELISA
Isotype kappa, Igg2a
Immunogen Sequence NAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPAG IKIINHPTMPNTQVVAIPNNANIHSIITALTAKGKESGSS GPNKFILIS
More Information Specificity

Human
Host Species Mouse
Clonality Monoclonal
Species Human

Synonyms

FKHL16, FOXM1B, HFH-11, HFH11, HNF-3, INS-1, MPHOSPH2, MPP-2, MPP2, PIG29, TGT3, TRIDENT

Description

Mouse monoclonal antibody raised against a full length recombinant FOXM1.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_202002

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (35.53 KDa).

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
Write Your Own Review
Your Rating
Submit a more detailed review for this product on Biocompare.com to receive an additional $20 Amazon gift card!

Ask a Question

Display name:
Your location:*