Human GALNT6 monoclonal antibody (100 ug)
$376.00
In stock
Code:
101-10602
-
+

Product Description

Specifications

Size 100 ug
Protein Name / Synonyms GALNAC-T6, GalNAcT6
Accession Number NP_009141
Gene Symbols GALNT6
Gene Id 11226
Applications WB, ELISA
Isotype kappa, Igg1
Immunogen Sequence IMYSCHGLGGNQYFEYTTQRDLRHNIAKQLCLHVSKGALG LGSCHFTGKNSQVPKDEEWELAQDQLIRNSGSGTCLTSQD KKPAMAPCNPSDPHQLWLFV
Gene Names GALNT6
More Information Specificity

Human
Host Species Mouse
Clonality Monoclonal
Species Human

Synonyms

GALNAC-T6, GalNAcT6

Description

Mouse monoclonal antibody raised against a partial recombinant GALNT6.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_007210

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (36.74 KDa).
Western blot analysis of GALNT6 over-expressed 293 cell line, cotransfected with GALNT6 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with GALNT6 monoclonal antibody . GAPDH ( 36.1 kDa ) used as specificity and loading control.
GALNT6 monoclonal antibody Western Blot analysis of GALNT6 expression in A-431 .
Western Blot analysis of GALNT6 expression in transfected 293T cell line by GALNT6 monoclonal antibody . Lane 1: GALNT6 transfected lysate(71 KDa). Lane 2: Non-transfected lysate.
Detection limit for recombinant GST tagged GALNT6 is approximately 0.1ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
Write Your Own Review
Your Rating
Submit a more detailed review for this product on Biocompare.com to receive an additional $20 Amazon gift card!

Ask a Question

Display name:
Your location:*