Human HGD monoclonal antibody (100 ug)
$376.00
In stock
Code:
101-10709
-
+

Product Description

Specifications

Size 100 ug
Protein Name / Synonyms AKU, HGO
Accession Number NP_000178
Gene Symbols HGD
Gene Id 3081
Applications ELISA, IF
Isotype kappa, Igg2b
Immunogen Sequence CFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKAS RCLDENYHKCWEPLKSHFTPNSRNPAEPN
More Information Specificity

Human
Host Species Mouse
Clonality Monoclonal
Species Human

Synonyms

AKU, HGO

Description

Mouse monoclonal antibody raised against a partial recombinant HGD.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_000187

Preparation

Storage Buffer
1x PBS, pH 7.2

Immunofluorescence of monoclonal antibody to HGD on HeLa cell. [antibody concentration 10 ug/ml]
Detection limit for recombinant GST tagged HGD is approximately 0.3ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
Write Your Own Review
Your Rating
Submit a more detailed review for this product on Biocompare.com to receive an additional $20 Amazon gift card!

Ask a Question

Display name:
Your location:*