Human OTUB2 monoclonal antibody (100 ug)
$376.00
In stock
Code:
101-11172
-
+

Product Description

Specifications

Size 100 ug
Protein Name / Synonyms C14orf137, FLJ21916, MGC3102, OTB2, OTU2
Accession Number NP_075601
Gene Symbols OTUB2
Gene Id 78990
Applications ELISA, IP
Isotype kappa, Igg2a
Immunogen Sequence SASDHIVQFLRLLTSAFIRNRADFFRHFIDEEMDIKDFCT HEVEPMATECDHIQITALSQALSIALQVEYVDEMDTALNH HVFPEAATPSVYLLYKTSHYNILYAADKH
Gene Names OTUB2
More Information Specificity

Human
Host Species Mouse
Clonality Monoclonal
Species Human

Synonyms

C14orf137, FLJ21916, MGC3102, OTB2, OTU2

Description

Mouse monoclonal antibody raised against a partial recombinant OTUB2.

Source

Specificity
Human

Gene Information

Gene Accession #
NM_023112

Preparation

Storage Buffer
1x PBS, pH 7.2

Immunoprecipitation of OTUB2 transfected lysate using anti-OTUB2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with OTUB2 MaxPab rabbit polyclonal antibody.
Detection limit for recombinant GST tagged OTUB2 is 1 ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
Write Your Own Review
Your Rating
Submit a more detailed review for this product on Biocompare.com to receive an additional $20 Amazon gift card!

Ask a Question

Display name:
Your location:*