Human PBK monoclonal antibody (100 ug)
$376.00
In stock
Code:
101-11196
-
+

Product Description

Specifications

Size 100 ug
Protein Name / Synonyms FLJ14385, Nori-3, SPK, TOPK
Accession Number AAH15191
Gene Symbols PBK
Gene Id 55872
Applications WB, ELISA, IHC, IF
Isotype kappa, Igg2b
Immunogen Sequence MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGF GTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQK RLMDEAKILKSLHHPNIVGYRAFTEANDGS
Gene Names PBK
More Information Specificity

Human
Host Species Mouse
Clonality Monoclonal
Species Human

Synonyms

FLJ14385, Nori-3, SPK, TOPK

Description

Mouse monoclonal antibody raised against a partial recombinant PBK.

Source

Specificity
Human

Gene Information

Gene Accession #
BC015191

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (37.73 KDa).
PBK monoclonal antibody Western Blot analysis of PBK expression in Y-79 .
PBK monoclonal antibody Western Blot analysis of PBK expression in Hela NE .
PBK monoclonal antibody Western Blot analysis of PBK expression in 293 .
Immunoperoxidase of monoclonal antibody to PBK on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
Immunofluorescence of monoclonal antibody to PBK on HeLa cell. [antibody concentration 10 ug/ml]

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
Write Your Own Review
Your Rating
Submit a more detailed review for this product on Biocompare.com to receive an additional $20 Amazon gift card!

Ask a Question

Display name:
Your location:*