Human PIK3CG monoclonal antibody (100 ug)
$376.00
In stock
Code:
101-11254
-
+

Product Description

Specifications

Size 100 ug
Protein Name / Synonyms PI3CG, PI3K, PI3Kgamma, PIK3
Accession Number AAH35683
Gene Symbols PIK3CG
Gene Id 5294
Applications WB, ELISA, IF, PLA
Isotype kappa, Igg2a
Immunogen Sequence MELENYKQPVVLREDNCRRRRRMKPRSAAASLSSMELIPI EFVLPTSQRKCKSPETALLHVAGHGNVEQMKAQVWLRALE TSVAADFYHRLGPHHFLLLY
More Information Specificity

Human
Host Species Mouse
Clonality Monoclonal
Species Human

Synonyms

PI3CG, PI3K, PI3Kgamma, PIK3

Description

Mouse monoclonal antibody raised against a partial recombinant PIK3CG.

Source

Specificity
Human

Gene Information

Gene Accession #
BC035683

Preparation

Storage Buffer
1x PBS, pH 7.2

Western Blot detection against Immunogen (37 KDa).
Proximity Ligation Analysis of protein-protein interactions between KIT and PIK3CG HeLa cells were stained with anti-KIT rabbit purified polyclonal 1:1200 and anti-PIK3CG mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Immunofluorescence of monoclonal antibody to PIK3CG on HeLa cell. [antibody concentration 10 ug/ml]
Detection limit for recombinant GST tagged PIK3CG is approximately 10ng/ml as a capture antibody.

Storage

Storage Recommendations
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration:
12 months from the date of shipment when stored properly.
Write Your Own Review
Your Rating
Submit a more detailed review for this product on Biocompare.com to receive an additional $20 Amazon gift card!

Ask a Question

Display name:
Your location:*